r0751.comHome NavigationNavigation
Home >  Games >  Casual >  Magic Sea - Match Puzzle
Magic Sea - Match Puzzle

Magic Sea - Match Puzzle

Category:Casual Size:48.3 MB Version:1.0.1

Rate:3.4 Update:Mar 09,2025

3.4
Download
Application Description

Aclassic3matchpuzzlegamewithanoceantheme.ThisisaSeaWorldthemed3matchpuzzlegame,youcanhaveawonderfulpuzzleexperiencewiththelovelyseaanimals.Therulesofthegamearesimple:youneedtofindthreedesignatedanimalsinawidevarietyofMarineanimalsandcompletethematch.Youcanchallengealltheanimalstocompletethematch,cometothismagicalunderwaterworld,andexperiencethefunofmatch!What'sNewintheLatestVersion1.0.1LastupdatedonDec18,2024Minorbugfixesandimprovements.Installorupdatetothenewestversiontocheckitout!

Screenshot
Magic Sea - Match Puzzle Screenshot 0
Magic Sea - Match Puzzle Screenshot 1
Magic Sea - Match Puzzle Screenshot 2
Magic Sea - Match Puzzle Screenshot 3
Reviews Post Comments
Games like Magic Sea - Match Puzzle
Latest Articles
  • Metal Gear Solid Delta Reveals Opening Movie

    ​ As we approach the August launch of Metal Gear Solid Delta: Snake Eater, Konami has unveiled the stealth game's cinematic opening sequence. While containing subtle variations, longtime fans will immediately recognize the iconic visuals and soundtrac

    Author : Hazel View All

  • Mortal Kombat 1 Adds Fan-Favorite Kameo Fighter Madam Bo

    ​ Mortal Kombat 1 has revealed gameplay footage of a fresh Kameo fighter arriving this March. Learn all about Madam Bo's unique fighting style and what she contributes to the roster!Mortal Kombat 1 Welcomes Madam BoNew Kameo FighterThe fighting game ha

    Author : Aiden View All

  • Kojima Tweaks Death Stranding 2 After Playtester Feedback

    ​ Death Stranding 2: On the Beach director Hideo Kojima allegedly revamped the game mid-development after playtests yielded results that were "too positive" - a scenario that contradicted his artistic preference against creating mainstream content.The

    Author : Penelope View All

Topics
Top Sports News and Score Apps
Top Sports News and Score AppsTOP

Stay up-to-date on all the latest sports news and scores with our curated collection of top-rated mobile apps! Whether you're a football fanatic, basketball buff, or tennis aficionado, we've got you covered. Download and enjoy games like MYFM - Online Football Manager, Super Soccer - 3V3, Hot Dunk Basketball, Synchronized Swimming, Rocket Car Ball, Tennis Clash, Tennis World Open 2023 - Sport Mod, Head Soccer, Mobile Soccer League 2024, and Mini Tennis. Find your favorite sport and dive into the action! This page features a selection of the best sports apps for Android and iOS, offering a mix of realistic simulations and fun arcade-style games. Discover your next favorite sports app today!